PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10015266m
Common NameCICLE_v10015266mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 442aa    MW: 48166.3 Da    PI: 6.4699
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10015266mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.5e-28169223156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Ciclev10015266m 169 KMKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 223
                      5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.193166225IPR017930Myb domain
SuperFamilySSF466891.34E-18167226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-27167226IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-26169223IPR006447Myb domain, plants
PfamPF002494.7E-8172221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MLAVSPLPNT SKDENQGEMA STFAIDTHEF PDFSDTNLLD SIDFDDLFAG INDSDVLPDL  60
EMDPEILAEF SAGGGDQESE MKASASVEKV EENNFKKEEE DKVSSCGSGA ASGSASGSNF  120
SKEEEIVSKR EEPVSASLKT LAKDGDKGRS KSSTQTKNNN NNNNQGKRKM KVDWTPELHR  180
RFVQAVEQLG VDKAVPSRIL ELMGIDCLTR HNIASHLQKY RSHRKHLLAR EAEAASWSHR  240
RQMYGGATVP SGGKRDMNPW IAPTMGFPPM TPPMHPPHFR PLHVWGHPSM DQSLMHMWPK  300
PVAHSPPPLP QTATVPPSWA QPRPPHWHHQ QVPNGLTPGT PCLLQPLATT RFPAPPVPGI  360
PSHHHAMYKV EPPGIGVPTG QSGPHPLIDF HPSIESIDAA IGDVLSKPWQ PLPLGLKPPS  420
LDSVMGELQR QGVPNIPPSC A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-16166221257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090027e-54AC209002.1 Populus trichocarpa clone POP040-E22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446694.10.0hypothetical protein CICLE_v10015266mg
SwissprotQ9SIV31e-107GLK1_ARATH; Transcription activator GLK1
TrEMBLV4W1Z80.0V4W1Z8_9R
STRINGPOPTR_0007s01230.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.18e-91GBF's pro-rich region-interacting factor 1